Lineage for d4wq0a_ (4wq0 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005886Species Streptomyces avermitilis [TaxId:33903] [189294] (7 PDB entries)
  8. 2005893Domain d4wq0a_: 4wq0 A: [278764]
    automated match to d4aw3a_
    complexed with efo, hem

Details for d4wq0a_

PDB Entry: 4wq0 (more details), 2.7 Å

PDB Description: crystal structure of cytochrome p450 cyp107w1 from streptomyces avermitilis in complex with oligomycin a
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d4wq0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wq0a_ a.104.1.0 (A:) automated matches {Streptomyces avermitilis [TaxId: 33903]}
piafpfpdppsvcelppelaeirdgqsvvevkfpdgisgwmvtkhadvrkvlvdsrfssk
vmataaaamsetetgklmneslvgmdapehtrlrklvtkaftarrvetlrpritelvgql
ldeletlprpvdlvknfsvplpvrvicellgvpagdqdtfhawsnallgdwqqvvekeaa
tvslvnyfgeliavkrenpaddliseliaisdgdstltereiialsigilsaghettanq
ismflvtllhnpeeldklrdnreaipkavdellrfvpltttggiiprlttaevelsggqv
lpagavvlpavatanrdpevfedgerlnvtrennphlafgagihhclgaqlarielqeal
gaildrmpqvrlavpeselrlksasiirgleslpitw

SCOPe Domain Coordinates for d4wq0a_:

Click to download the PDB-style file with coordinates for d4wq0a_.
(The format of our PDB-style files is described here.)

Timeline for d4wq0a_: