![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Streptomyces avermitilis [TaxId:33903] [189294] (7 PDB entries) |
![]() | Domain d4wq0a_: 4wq0 A: [278764] automated match to d4aw3a_ complexed with efo, hem |
PDB Entry: 4wq0 (more details), 2.7 Å
SCOPe Domain Sequences for d4wq0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wq0a_ a.104.1.0 (A:) automated matches {Streptomyces avermitilis [TaxId: 33903]} piafpfpdppsvcelppelaeirdgqsvvevkfpdgisgwmvtkhadvrkvlvdsrfssk vmataaaamsetetgklmneslvgmdapehtrlrklvtkaftarrvetlrpritelvgql ldeletlprpvdlvknfsvplpvrvicellgvpagdqdtfhawsnallgdwqqvvekeaa tvslvnyfgeliavkrenpaddliseliaisdgdstltereiialsigilsaghettanq ismflvtllhnpeeldklrdnreaipkavdellrfvpltttggiiprlttaevelsggqv lpagavvlpavatanrdpevfedgerlnvtrennphlafgagihhclgaqlarielqeal gaildrmpqvrlavpeselrlksasiirgleslpitw
Timeline for d4wq0a_: