Lineage for d1ugb__ (1ugb -)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 566493Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 566494Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) (S)
  5. 566495Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)
  6. 566496Protein Carbonic anhydrase [51071] (10 species)
  7. 566514Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (154 PDB entries)
  8. 566579Domain d1ugb__: 1ugb - [27876]
    complexed with azi, zn; mutant

Details for d1ugb__

PDB Entry: 1ugb (more details), 2 Å

PDB Description: human carbonic anhydrase ii[hcaii] (e.c.4.2.1.1) mutant with ala 65 replaced by gly (a65g)

SCOP Domain Sequences for d1ugb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugb__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghgfnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

SCOP Domain Coordinates for d1ugb__:

Click to download the PDB-style file with coordinates for d1ugb__.
(The format of our PDB-style files is described here.)

Timeline for d1ugb__: