![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
![]() | Protein automated matches [190457] (10 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [225620] (18 PDB entries) |
![]() | Domain d4rtxc1: 4rtx C:85-141 [278759] Other proteins in same PDB: d4rtxa2, d4rtxb2, d4rtxc2, d4rtxd2 automated match to d4omoa_ complexed with epe, ni, so4; mutant |
PDB Entry: 4rtx (more details), 1.32 Å
SCOPe Domain Sequences for d4rtxc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rtxc1 b.34.2.0 (C:85-141) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} tfvalydyesrgetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvapsd
Timeline for d4rtxc1: