Lineage for d4rtxd1 (4rtx D:85-141)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2377019Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2377486Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2377487Protein automated matches [190457] (10 species)
    not a true protein
  7. 2377519Species Chicken (Gallus gallus) [TaxId:9031] [225620] (14 PDB entries)
  8. 2377528Domain d4rtxd1: 4rtx D:85-141 [278757]
    Other proteins in same PDB: d4rtxa2, d4rtxb2, d4rtxc2, d4rtxd2
    automated match to d4omoa_
    complexed with epe, ni, so4; mutant

Details for d4rtxd1

PDB Entry: 4rtx (more details), 1.32 Å

PDB Description: crystal structure of the src tyrosine kinase sh3 domain t96g/q128r mutant
PDB Compounds: (D:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d4rtxd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rtxd1 b.34.2.0 (D:85-141) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
tfvalydyesrgetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvapsd

SCOPe Domain Coordinates for d4rtxd1:

Click to download the PDB-style file with coordinates for d4rtxd1.
(The format of our PDB-style files is described here.)

Timeline for d4rtxd1: