Lineage for d1ugd__ (1ugd -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) 
Family b.74.1.1: Carbonic anhydrase [51070] (1 protein) Protein Carbonic anhydrase [51071] (8 species) Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (128 PDB entries) 
Domain d1ugd__: 1ugd - [27872]
Details for d1ugd__
PDB Entry: 1ugd (more details), 2 Å
PDB Description: human carbonic anhydrase ii[hcaii] (e.c.4.2.1.1) mutant with ala 65 replaced by ser (a65s)
SCOP Domain Sequences for d1ugd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ugd__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghsfnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk
SCOP Domain Coordinates for d1ugd__:
Click to download the PDB-style file with coordinates for d1ugd__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ugd__:
- d1ugd__ appears in SCOP 1.57
- d1ugd__ appears in the current release, SCOPe 2.08, called d1ugda_
View in 3D