Lineage for d2n79c_ (2n79 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711123Protein Troponin C [47503] (6 species)
  7. 2711158Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (28 PDB entries)
  8. 2711175Domain d2n79c_: 2n79 C: [278710]
    automated match to d2kfxt_
    complexed with ca; mutant

    fragment; missing more than one-third of the common structure and/or sequence

Details for d2n79c_

PDB Entry: 2n79 (more details)

PDB Description: the structural and functional effects of the familial hypertrophic cardiomyopathy-linked cardiac troponin c mutation, l29q
PDB Compounds: (C:) troponin c, slow skeletal and cardiac muscles

SCOPe Domain Sequences for d2n79c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n79c_ a.39.1.5 (C:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
mddiykaaveqlteeqknefkaafdifvqgaedgsistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdeflvmmvrsmkdds

SCOPe Domain Coordinates for d2n79c_:

Click to download the PDB-style file with coordinates for d2n79c_.
(The format of our PDB-style files is described here.)

Timeline for d2n79c_: