SCOP 1.75: Domain d1ugca_: 1ugc A:

Lineage for d1ugca_ (1ugc A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (1 family)

5. Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (218 PDB entries)
   Uniprot P00918

8. Domain d1ugca_: 1ugc A: [27871]
   complexed with hg, zn; mutant

Details for d1ugca_

PDB Entry: 1ugc, 2 Å

PDB Description: human carbonic anhydrase ii [hcaii] (e.c.4.2.1.1) mutant with ala 65 replaced by his (a65h)

PDB Compounds: (A:) carbonic anhydrase II

SCOP Domain Sequences for d1ugca_:

Sequence; same for both SEQRES and ATOM records:

>d1ugca_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghhfnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

Timeline for d1ugca_:

• d1ugca_ first appeared (with stable ids) in SCOP 1.55, called d1ugc__
  
• d1ugca_ appears in SCOP 1.73
  
• d1ugca_ appears in SCOPe 2.01
  
• d1ugca_ appears in the current release, SCOPe 2.08