SCOPe 2.08: Domain d5e8eb2: 5e8e B:126-229

Lineage for d5e8eb2 (5e8e B:126-229)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5e8eb2: 5e8e B:126-229 [278704]
   Other proteins in same PDB: d5e8ea1, d5e8ea2
   automated match to d1dn0b2
   complexed with 0g6, cit, na, peg, po4

Details for d5e8eb2

PDB Entry: 5e8e, 1.9 Å

PDB Description: crystal structure of thrombin bound to an exosite 1-specific iga fab

PDB Compounds: (B:) iga fab heavy chain

SCOPe Domain Sequences for d5e8eb2:

Sequence; same for both SEQRES and ATOM records:

>d5e8eb2 b.1.1.0 (B:126-229) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stpvspkvfplslcstqpdgnvviaclvqgffpqeplsvtwsesgqgvtarnfppsqdas
gdlyttssqltlpatqclagksvtchvkhytnpsqdvtvpcpvp

Timeline for d5e8eb2:

• d5e8eb2 first appeared in SCOPe 2.05
  
• d5e8eb2 appears in SCOPe 2.07