Lineage for d5e8eb1 (5e8e B:1-125)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754777Domain d5e8eb1: 5e8e B:1-125 [278703]
    Other proteins in same PDB: d5e8ea1, d5e8ea2
    automated match to d1dn0b1
    complexed with 0g6, cit, na, peg, po4

Details for d5e8eb1

PDB Entry: 5e8e (more details), 1.9 Å

PDB Description: crystal structure of thrombin bound to an exosite 1-specific iga fab
PDB Compounds: (B:) iga fab heavy chain

SCOPe Domain Sequences for d5e8eb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e8eb1 b.1.1.0 (B:1-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqliqsgsavkkpgasvrvsckvsgytlteaaihwvrqapgkglewmggldpqdgetvy
aqqfkgrvtmtedrstdtaymevnnlrsedtatyycttgdfsefepfsmdyfhfwgqgtv
vtvas

SCOPe Domain Coordinates for d5e8eb1:

Click to download the PDB-style file with coordinates for d5e8eb1.
(The format of our PDB-style files is described here.)

Timeline for d5e8eb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5e8eb2