Lineage for d5e56a_ (5e56 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741777Protein Immunoreceptor CTLA-4 (CD152), N-terminal fragment [48939] (2 species)
  7. 2741790Species Mouse (Mus musculus) [TaxId:10090] [48941] (3 PDB entries)
  8. 2741791Domain d5e56a_: 5e56 A: [278693]
    automated match to d1dqta_
    complexed with na

Details for d5e56a_

PDB Entry: 5e56 (more details), 1.5 Å

PDB Description: crystal structure of mouse ctla-4
PDB Compounds: (A:) cytotoxic t-lymphocyte protein 4

SCOPe Domain Sequences for d5e56a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e56a_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]}
iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvid

SCOPe Domain Coordinates for d5e56a_:

Click to download the PDB-style file with coordinates for d5e56a_.
(The format of our PDB-style files is described here.)

Timeline for d5e56a_: