Lineage for d5dwnd_ (5dwn D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969042Species Brucella ovis [TaxId:444178] [278686] (2 PDB entries)
  8. 2969050Domain d5dwnd_: 5dwn D: [278690]
    Other proteins in same PDB: d5dwna2, d5dwnb2
    automated match to d2j8ma_
    complexed with aco, cl, mg

Details for d5dwnd_

PDB Entry: 5dwn (more details), 1.95 Å

PDB Description: crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa PDB Compounds: (D:) Phosphinothricin N-acetyltransferase

SCOPe Domain Sequences for d5dwnd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dwnd_ d.108.1.0 (D:) automated matches {Brucella ovis [TaxId: 444178]}
mpvirdfqpadietitaiytqavltgtgsyeiepptmdemakrfaafadqgfpilvaead
grvlgyayasyfrvrpayrwlaedsiyiapdakgqgigklllreliarisalgfrqllav
igdgehnigsvklheslgfthcgriegsgfkhgrwldtvlmqlplnggrstepgpspls

SCOPe Domain Coordinates for d5dwnd_:

Click to download the PDB-style file with coordinates for d5dwnd_.
(The format of our PDB-style files is described here.)

Timeline for d5dwnd_: