Lineage for d5dmkc2 (5dmk C:85-173)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753033Domain d5dmkc2: 5dmk C:85-173 [278682]
    Other proteins in same PDB: d5dmka1, d5dmkc1, d5dmke1, d5dmkg1
    automated match to d1es0a1
    complexed with flc

Details for d5dmkc2

PDB Entry: 5dmk (more details), 2.45 Å

PDB Description: crystal structure of iag7 in complex with rlgl-we14
PDB Compounds: (C:) H-2 class II histocompatibility antigen, A-D alpha chain

SCOPe Domain Sequences for d5dmkc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dmkc2 b.1.1.2 (C:85-173) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgle

SCOPe Domain Coordinates for d5dmkc2:

Click to download the PDB-style file with coordinates for d5dmkc2.
(The format of our PDB-style files is described here.)

Timeline for d5dmkc2: