Lineage for d5dmhb_ (5dmh B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2152074Fold c.146: YgbK-like [142763] (1 superfamily)
    consists of two domains with partial topological similarity to the P-loop kinases but without the P-loop motif; the domain association results in the formation of a single mixed beta-sheet of 15 strands
  4. 2152075Superfamily c.146.1: YgbK-like [142764] (2 families) (S)
  5. 2152085Family c.146.1.0: automated matches [271064] (1 protein)
    not a true family
  6. 2152086Protein automated matches [271065] (2 species)
    not a true protein
  7. 2152087Species Cupriavidus necator [TaxId:381666] [278672] (1 PDB entry)
  8. 2152089Domain d5dmhb_: 5dmh B: [278673]
    automated match to d3dqqb_
    complexed with adp

Details for d5dmhb_

PDB Entry: 5dmh (more details), 1.8 Å

PDB Description: crystal structure of a domain of unknown function (duf1537) from ralstonia eutropha h16 (h16_a1561), target efi-511666, complex with adp.
PDB Compounds: (B:) Uncharacterized protein conserved in bacteria

SCOPe Domain Sequences for d5dmhb_:

Sequence, based on SEQRES records: (download)

>d5dmhb_ c.146.1.0 (B:) automated matches {Cupriavidus necator [TaxId: 381666]}
rpllgciaddftgatdlantlvrngmrtvqtiglpdvgavqdigeadalvvalksrtipa
veavaqslaalqwlraqgcrqfvfkycstfdstdagnigpvaeallaaldsdftiacpaf
pengrtifrghlfvgdallnesgmehhpltpmtdaslvrvlqrqsknkvgllrydavarg
ahataeriaalrsdgvrmaiadavsdadlftlgeacanlplitggsgialglpenfrrag
llpqrgdaasvpaidgpgvvlagsasratngqvarwleqgrpalridplalargeavada
alafaaghgepvliyatsspdevkavqaelgveraghlveqclatvaagllargtrrfvv
aggetsgavvqalgvralrigaqiapgvpatvtldakplalalksgnfggpdffdealrq
lggh

Sequence, based on observed residues (ATOM records): (download)

>d5dmhb_ c.146.1.0 (B:) automated matches {Cupriavidus necator [TaxId: 381666]}
rpllgciaddftgatdlantlvrngmrtvqtiglpgeadalvvalksrtipaveavaqsl
aalqwlraqgcrqfvfkycstfdstdagnigpvaeallaaldsdftiacpafpengrtif
rghlfvgdallnesgmehhpltpmtdaslvrvlqrqsknkvgllrydavargahataeri
aalrsdgvrmaiadavsdadlftlgeacanlplitggsgialglpenfrragllpqrgda
asvpaidgpgvvlagsasratngqvarwleqgrpalridplalargeavadaalafaagh
gepvliyatsspdevkavqaelgveraghlveqclatvaagllargtrrfvvaggetsga
vvqalgvralrigaqiapgvpatvtldakplalalksgnfggpdffdealrqlggh

SCOPe Domain Coordinates for d5dmhb_:

Click to download the PDB-style file with coordinates for d5dmhb_.
(The format of our PDB-style files is described here.)

Timeline for d5dmhb_: