Lineage for d1ugea_ (1uge A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2067964Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2067965Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2067966Family b.74.1.1: Carbonic anhydrase [51070] (2 protein domains)
    automatically mapped to Pfam PF00194
  6. 2067967Protein Carbonic anhydrase [51071] (10 species)
  7. 2068005Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (675 PDB entries)
    Uniprot P00918
  8. 2068350Domain d1ugea_: 1uge A: [27865]
    complexed with hg, zn; mutant

Details for d1ugea_

PDB Entry: 1uge (more details), 1.9 Å

PDB Description: human carbonic anhydrase ii [hcaii] (e.c.4.2.1.1) mutant with ala 65 replaced by leu (a65l)
PDB Compounds: (A:) carbonic anhydrase II

SCOPe Domain Sequences for d1ugea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugea_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghlfnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

SCOPe Domain Coordinates for d1ugea_:

Click to download the PDB-style file with coordinates for d1ugea_.
(The format of our PDB-style files is described here.)

Timeline for d1ugea_: