![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
![]() | Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) ![]() |
![]() | Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins) automatically mapped to Pfam PF00194 |
![]() | Protein Carbonic anhydrase [51071] (10 species) |
![]() | Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (974 PDB entries) Uniprot P00918 |
![]() | Domain d1g48a_: 1g48 A: [27860] complexed with f6b, hg, zn |
PDB Entry: 1g48 (more details), 1.86 Å
SCOPe Domain Sequences for d1g48a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g48a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]} hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn ghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh wntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd nwrpaqplknrqikasfk
Timeline for d1g48a_: