Lineage for d5d1ka_ (5d1k A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898312Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1898313Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1898314Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1898322Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1898452Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (14 PDB entries)
    Uniprot P62837
    E2-17 kDa 2
  8. 1898461Domain d5d1ka_: 5d1k A: [278585]
    automated match to d1ur6a_
    complexed with edo, oxl, peg, zn

Details for d5d1ka_

PDB Entry: 5d1k (more details), 1.78 Å

PDB Description: crystal structure of ubch5b in complex with the ring-u5br fragment of ao7
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d5d1ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d1ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
alkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d5d1ka_:

Click to download the PDB-style file with coordinates for d5d1ka_.
(The format of our PDB-style files is described here.)

Timeline for d5d1ka_: