Lineage for d5d1la_ (5d1l A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546033Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2546034Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2546035Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2546043Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2546210Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (24 PDB entries)
    Uniprot P62837
    E2-17 kDa 2
  8. 2546217Domain d5d1la_: 5d1l A: [278584]
    automated match to d1ur6a_
    complexed with oxl, peg, zn

Details for d5d1la_

PDB Entry: 5d1l (more details), 1.62 Å

PDB Description: crystal structure of ubch5b in complex with the ring-u5br fragment of ao7 (y165a)
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d5d1la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d1la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
alkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d5d1la_:

Click to download the PDB-style file with coordinates for d5d1la_.
(The format of our PDB-style files is described here.)

Timeline for d5d1la_: