Lineage for d5cpyc_ (5cpy C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2076457Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2076458Family b.121.6.1: Papovaviridae-like VP [88649] (3 protein domains)
  6. 2076462Protein Polyomavirus coat proteins [49657] (2 species)
  7. 2076463Species Murine polyomavirus, strain small-plaque 16 [TaxId:10634] [49658] (11 PDB entries)
  8. 2076501Domain d5cpyc_: 5cpy C: [278566]
    automated match to d1vpsa_
    complexed with gal, gol, nga, sia

Details for d5cpyc_

PDB Entry: 5cpy (more details), 1.93 Å

PDB Description: crystal structure of murine polyomavirus pta strain vp1 in complex with the gd1a glycan
PDB Compounds: (C:) vp1

SCOPe Domain Sequences for d5cpyc_:

Sequence, based on SEQRES records: (download)

>d5cpyc_ b.121.6.1 (C:) Polyomavirus coat proteins {Murine polyomavirus, strain small-plaque 16 [TaxId: 10634]}
gmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspen
ntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntkg
istpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpis
kakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgpl
ckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk

Sequence, based on observed residues (ATOM records): (download)

>d5cpyc_ b.121.6.1 (C:) Polyomavirus coat proteins {Murine polyomavirus, strain small-plaque 16 [TaxId: 10634]}
gmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspen
ntlptwsmaklqlpmlntlqmweavsvktevvgsgslldvhgfnkptdtvntkgistpve
gsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpiskakldk
dgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgplckgegl
ylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk

SCOPe Domain Coordinates for d5cpyc_:

Click to download the PDB-style file with coordinates for d5cpyc_.
(The format of our PDB-style files is described here.)

Timeline for d5cpyc_: