Lineage for d5ce9b_ (5ce9 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002034Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 2002035Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 2002059Family a.86.1.2: Catechol oxidase [48061] (2 protein domains)
  6. 2002069Protein automated matches [190909] (2 species)
    not a true protein
  7. 2002072Species Juglans regia [TaxId:51240] [278546] (1 PDB entry)
  8. 2002074Domain d5ce9b_: 5ce9 B: [278547]
    automated match to d2p3xa_
    complexed with cu, na, o

Details for d5ce9b_

PDB Entry: 5ce9 (more details), 1.8 Å

PDB Description: structure of tyrosinase from walnut (juglans regia)
PDB Compounds: (B:) polyphenol oxidase

SCOPe Domain Sequences for d5ce9b_:

Sequence, based on SEQRES records: (download)

>d5ce9b_ a.86.1.2 (B:) automated matches {Juglans regia [TaxId: 51240]}
dpvsapeltlcseadlpagalpvnccpptskkikdfvlpsqntplrvrpaahlvdndyia
kynkgielmkslpaddprsftqqanvhcaycdgaytqvgfpdlslqihecwlffpfhryy
vyffekilgkligdptfalpfwnwdsppgmqlpslyavsnsaiydplrnanhqpptiidl
dygetsesttttdqvpsnlkimyrqmvsgaknptlffgspyragdepdpgagtiestphn
nihlwtgddtqpnienmgnfysagrdpiffahhsnvdrmwtiwktlggkrkditdpdwln
ssfffydenadpvrvkvkdcvdntklryvyqdveipwl

Sequence, based on observed residues (ATOM records): (download)

>d5ce9b_ a.86.1.2 (B:) automated matches {Juglans regia [TaxId: 51240]}
dpvsapeltlcseadlpagalpvnccpptskkikdfvlpsqntplrvrpaahlvdndyia
kynkgielmkslpaddprsftqqanvhcaycdgaytqvgfpdlslqihecwlffpfhryy
vyffekilgkligdptfalpfwnwdsppgmqlpslyavsnsaiydplrnanhqpptiidl
dygtttdqvpsnlkimyrqmvsgaknptlffgspyragdepdpgagtiestphnnihlwt
gddtqpnienmgnfysagrdpiffahhsnvdrmwtiwktlggkrkditdpdwlnssfffy
denadpvrvkvkdcvdntklryvyqdveipwl

SCOPe Domain Coordinates for d5ce9b_:

Click to download the PDB-style file with coordinates for d5ce9b_.
(The format of our PDB-style files is described here.)

Timeline for d5ce9b_: