Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species) PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [82796] (65 PDB entries) Uniprot P00533 702-1018 |
Domain d5caua_: 5cau A: [278545] automated match to d4li5a_ complexed with 4zr, so4; mutant |
PDB Entry: 5cau (more details), 2.25 Å
SCOPe Domain Sequences for d5caua_:
Sequence, based on SEQRES records: (download)
>d5caua_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspka nkeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyll nwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllgaaaaeyhaeggk vpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpq ppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptds nfyralmdeedmddvvdadeyli
>d5caua_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelspkankei ldeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcv qiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgraklvpikwmalesilhriyth qsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmi dadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfymddvvdadeyli
Timeline for d5caua_: