SCOP 1.55: Domain d1bic__: 1bic -

Lineage for d1bic__ (1bic -)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)

4. Superfamily b.74.1: Carbonic anhydrase [51069] (1 family)

5. Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)

6. Protein Carbonic anhydrase [51071] (8 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (128 PDB entries)

8. Domain d1bic__: 1bic - [27854]

Details for d1bic__

PDB Entry: 1bic, 1.9 Å

PDB Description: crystallographic analysis of thr-200-> his human carbonic anhydrase ii and its complex with the substrate, hco3-

SCOP Domain Sequences for d1bic__:

Sequence; same for both SEQRES and ATOM records:

>d1bic__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslthppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

Timeline for d1bic__:

• d1bic__ appears in SCOP 1.57
  
• d1bic__ appears in the current release, SCOPe 2.08, called d1bica_