SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5aelb_ (5ael B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010904Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2010905Protein automated matches [196409] (33 species)
    not a true protein
  7. 2011083Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [230726] (15 PDB entries)
  8. 2011114Domain d5aelb_: 5ael B: [278535]
    automated match to d2ogda_
    complexed with mg, qaf

Details for d5aelb_

PDB Entry: 5ael (more details), 2.6 Å

PDB Description: t. brucei farnesyl diphosphate synthase complexed with bisphosphonate bph-597
PDB Compounds: (B:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d5aelb_:

Sequence, based on SEQRES records: (download)

>d5aelb_ a.128.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
llslspnnngeeddgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyr
hpdvtvqcaindglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmf
dsnkldpdvsqptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvt
eelamlmgeyfqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefka
nygsgdsekvatvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwg
ktykrqk

Sequence, based on observed residues (ATOM records): (download)

>d5aelb_ a.128.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
llsdgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyrhpdvtvqcai
ndglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmfdsnkldpdvs
qptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvteelamlmgey
fqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefkanygsgdsekv
atvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwgktykrqk

SCOPe Domain Coordinates for d5aelb_:

Click to download the PDB-style file with coordinates for d5aelb_.
(The format of our PDB-style files is described here.)

Timeline for d5aelb_: