Lineage for d5afxa_ (5afx A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010904Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2010905Protein automated matches [196409] (36 species)
    not a true protein
  7. 2011083Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [230726] (15 PDB entries)
  8. 2011109Domain d5afxa_: 5afx A: [278533]
    automated match to d2ogda_
    complexed with mg, pvz

Details for d5afxa_

PDB Entry: 5afx (more details), 2.39 Å

PDB Description: t. brucei farnesyl diphosphate synthase complexed with bisphosphonate bph-1238
PDB Compounds: (A:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d5afxa_:

Sequence, based on SEQRES records: (download)

>d5afxa_ a.128.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
llslspnnngeeddgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyr
hpdvtvqcaindglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmf
dsnkldpdvsqptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvt
eelamlmgeyfqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefka
nygsgdsekvatvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwg
ktykrqk

Sequence, based on observed residues (ATOM records): (download)

>d5afxa_ a.128.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
llsdgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyrhpdvtvqcai
ndglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmfdsnkldpdvs
qptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvteelamlmgey
fqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefkanygsgdsekv
atvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwgktykrqk

SCOPe Domain Coordinates for d5afxa_:

Click to download the PDB-style file with coordinates for d5afxa_.
(The format of our PDB-style files is described here.)

Timeline for d5afxa_: