Lineage for d5adib_ (5adi B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3003148Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 3003149Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 3003150Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 3004094Protein automated matches [190421] (6 species)
    not a true protein
  7. 3004267Species Human (Homo sapiens) [TaxId:9606] [187302] (87 PDB entries)
  8. 3004421Domain d5adib_: 5adi B: [278517]
    automated match to d3hsob_
    complexed with h4b, hem, tue, zn; mutant

Details for d5adib_

PDB Entry: 5adi (more details), 2.2 Å

PDB Description: structure of human nnos r354a g357d mutant heme domain in complex with 7-(((5-((methylamino)methyl)pyridin-3-yl)oxy) methyl)quinolin-2-amine
PDB Compounds: (B:) Nitric oxide synthase, brain

SCOPe Domain Sequences for d5adib_:

Sequence, based on SEQRES records: (download)

>d5adib_ d.174.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rflkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfpla
kefidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcvgr
iqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsq
liryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqipp
elvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdy
cdnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesf
ikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwk

Sequence, based on observed residues (ATOM records): (download)

>d5adib_ d.174.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rflkvknwetevvltdtlhlkstletgcteyicmgsimhpatkdqlfplakefidqyyss
ikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcvgriqwsklqvfd
ardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryagykqp
dgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqippelvlevpirh
pkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdnsrynile
evakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmeneyrc
rggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwk

SCOPe Domain Coordinates for d5adib_:

Click to download the PDB-style file with coordinates for d5adib_.
(The format of our PDB-style files is described here.)

Timeline for d5adib_: