Lineage for d1g46a_ (1g46 A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 114637Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
  4. 114638Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) (S)
  5. 114639Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)
  6. 114640Protein Carbonic anhydrase [51071] (9 species)
  7. 114655Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (144 PDB entries)
  8. 114691Domain d1g46a_: 1g46 A: [27851]

Details for d1g46a_

PDB Entry: 1g46 (more details), 1.84 Å

PDB Description: carbonic anhydrase ii (f131v) complexed with 4-(aminosulfonyl)-n-[(2, 3-difluorophenyl)methyl]-benzamide

SCOP Domain Sequences for d1g46a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g46a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

SCOP Domain Coordinates for d1g46a_:

Click to download the PDB-style file with coordinates for d1g46a_.
(The format of our PDB-style files is described here.)

Timeline for d1g46a_: