SCOP 1.73: Domain d1cnja_: 1cnj A:

Lineage for d1cnja_ (1cnj A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (1 family)

5. Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (197 PDB entries)

8. Domain d1cnja_: 1cnj A: [27850]
   complexed with hg, zn; mutant

Details for d1cnja_

PDB Entry: 1cnj, 1.8 Å

PDB Description: x-ray crystallographic studies of engineered hydrogen bond networks in a protein-zinc binding site

PDB Compounds: (A:) carbonic anhydrase II

SCOP Domain Sequences for d1cnja_:

Sequence; same for both SEQRES and ATOM records:

>d1cnja_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hafnvefddsqdkavlkggpldgtyrlinfhfhwgsldgqgsehtvdkkkyaaelhlvhw
ntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgl
lpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasfk

Timeline for d1cnja_:

• d1cnja_ first appeared (with stable ids) in SCOP 1.55, called d1cnj__
  
• d1cnja_ was called d1cnj__ in SCOP 1.71
  
• d1cnja_ appears in SCOP 1.75
  
• d1cnja_ appears in the current release, SCOPe 2.08