SCOPe 2.08: Domain d4zptl2: 4zpt L:108-212

Lineage for d4zptl2 (4zpt L:108-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4zptl2: 4zpt L:108-212 [278493]
   Other proteins in same PDB: d4zpta_, d4zptb1, d4zpth_, d4zptl1
   automated match to d2v7ha2
   complexed with nag

Details for d4zptl2

PDB Entry: 4zpt, 2.59 Å

PDB Description: structure of mers-coronavirus spike receptor-binding domain (england1 strain) in complex with vaccine-elicited murine neutralizing antibody d12 (crystal form 1)

PDB Compounds: (L:) D12 Fab Light chain

SCOPe Domain Sequences for d4zptl2:

Sequence; same for both SEQRES and ATOM records:

>d4zptl2 b.1.1.2 (L:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d4zptl2:

• d4zptl2 first appeared in SCOPe 2.05
  
• d4zptl2 appears in SCOPe 2.07