SCOPe 2.08: Domain d4zptb1: 4zpt B:1-107

Lineage for d4zptb1 (4zpt B:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4zptb1: 4zpt B:1-107 [278490]
   Other proteins in same PDB: d4zpta_, d4zptb2, d4zpth_, d4zptl2
   automated match to d2v7ha1
   complexed with nag

Details for d4zptb1

PDB Entry: 4zpt, 2.59 Å

PDB Description: structure of mers-coronavirus spike receptor-binding domain (england1 strain) in complex with vaccine-elicited murine neutralizing antibody d12 (crystal form 1)

PDB Compounds: (B:) D12 Fab Light chain

SCOPe Domain Sequences for d4zptb1:

Sequence; same for both SEQRES and ATOM records:

>d4zptb1 b.1.1.0 (B:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqttsslsaslgdrvtiicrasqdinnylnwyqqkpdgtvklliyytsrlhsgvps
rfsgsgsgsdysltisnleqediatyfcqqantlpptfgagtklelr

Timeline for d4zptb1:

• d4zptb1 first appeared in SCOPe 2.05
  
• d4zptb1 appears in SCOPe 2.07