SCOPe 2.06: Domain d4ykjb_: 4ykj B:

Lineage for d4ykjb_ (4ykj B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Mnemiopsis leidyi [TaxId:27923] [278472] (6 PDB entries)

8. Domain d4ykjb_: 4ykj B: [278480]
   automated match to d2i0cb_
   complexed with ala, gly

Details for d4ykjb_

PDB Entry: 4ykj, 1.4 Å

PDB Description: mnemiopsis leidyi ml032222a iglur lbd complex with alanine

PDB Compounds: (B:) ML032222a iGluR

SCOPe Domain Sequences for d4ykjb_:

Sequence; same for both SEQRES and ATOM records:

>d4ykjb_ c.94.1.0 (B:) automated matches {Mnemiopsis leidyi [TaxId: 27923]}
gsknligrhlrlgsveeqpfmffategcegndcwsgmvndmvvklsedlgftyeyiqpdd
rkfgalnkttnewngmirdllddktdmiaidlstnsarksaidysfpfmdagikavvkge
gttlnqvlelldqdkykwgvigsrhpetllkthrdsrysrlvdegvelkdlnhaietlrg
glfvfidegpvlahnlisdcdvfsvgeefqsfeyafglpkdspykslidshllkfreegf
idilwekwssgnsvc

Timeline for d4ykjb_:

• d4ykjb_ first appeared in SCOPe 2.05
  
• d4ykjb_ appears in SCOPe 2.07
  
• d4ykjb_ appears in the current release, SCOPe 2.08