Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.1: RNI-like [52047] (4 families) regular structure consisting of similar repeats |
Family c.10.1.0: automated matches [257495] (1 protein) not a true family |
Protein automated matches [257496] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [278142] (3 PDB entries) |
Domain d4z79a_: 4z79 A: [278477] automated match to d1io0a_ complexed with cl, gol, na |
PDB Entry: 4z79 (more details), 1.54 Å
SCOPe Domain Sequences for d4z79a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z79a_ c.10.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} apsifdeplervknndpemtevnvnnsdcitneilvrftealefntvvklfalantradd hvafaiaimlkanktitslnldsnhitgkgilaifrallqnntltelrfhnqrhicggkt emeiakllkenttllklgyhfelagprmtvtnllsrnmdkqrqkrlqeqrqaq
Timeline for d4z79a_: