Lineage for d4xwjb_ (4xwj B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1919250Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 1919251Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 1919252Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. 1919269Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species)
  7. 1919296Species Escherichia coli [TaxId:562] [55599] (18 PDB entries)
  8. 1919304Domain d4xwjb_: 4xwj B: [278462]
    automated match to d1poha_

Details for d4xwjb_

PDB Entry: 4xwj (more details), 2.1 Å

PDB Description: histidine-containing phosphocarrier protein (hpr) and antisigma factor rsd complex
PDB Compounds: (B:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d4xwjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xwjb_ d.94.1.1 (B:) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli [TaxId: 562]}
msqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmae

SCOPe Domain Coordinates for d4xwjb_:

Click to download the PDB-style file with coordinates for d4xwjb_.
(The format of our PDB-style files is described here.)

Timeline for d4xwjb_: