![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) ![]() |
![]() | Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
![]() | Protein automated matches [190418] (18 species) not a true protein |
![]() | Species Acinetobacter sp. [TaxId:1071390] [278459] (1 PDB entry) |
![]() | Domain d4xuka_: 4xuk A: [278460] automated match to d4le6d_ complexed with zn |
PDB Entry: 4xuk (more details), 2 Å
SCOPe Domain Sequences for d4xuka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xuka_ d.157.1.0 (A:) automated matches {Acinetobacter sp. [TaxId: 1071390]} kqvagyyqyqagdvqitalldgtnfmspnlfkdipqqqvheilkkyyadqekgvqtsina flvnigkslilidsgaascfgshlgsvlsnlkasgyqpeqvdtillthlhpdhvcgiskd gvanfpnatvyvsndeasfwldpkqaaklpkekqanylgtvekikqaiapyqakqrfkty klgddiqgfkvintaghtpghfsyelktkgesivfigdivhshtvqfdrpetaieydidp kkavetrlkqfanfakngqtiaaphlpfpgightysadgksyqwipihfkd
Timeline for d4xuka_: