Lineage for d4xuka_ (4xuk A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231713Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2231714Protein automated matches [190418] (18 species)
    not a true protein
  7. 2231718Species Acinetobacter sp. [TaxId:1071390] [278459] (1 PDB entry)
  8. 2231719Domain d4xuka_: 4xuk A: [278460]
    automated match to d4le6d_
    complexed with zn

Details for d4xuka_

PDB Entry: 4xuk (more details), 2 Å

PDB Description: crystal structure of hydrolase aboph in beta lactamase superfamily
PDB Compounds: (A:) Putative hydrolase

SCOPe Domain Sequences for d4xuka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xuka_ d.157.1.0 (A:) automated matches {Acinetobacter sp. [TaxId: 1071390]}
kqvagyyqyqagdvqitalldgtnfmspnlfkdipqqqvheilkkyyadqekgvqtsina
flvnigkslilidsgaascfgshlgsvlsnlkasgyqpeqvdtillthlhpdhvcgiskd
gvanfpnatvyvsndeasfwldpkqaaklpkekqanylgtvekikqaiapyqakqrfkty
klgddiqgfkvintaghtpghfsyelktkgesivfigdivhshtvqfdrpetaieydidp
kkavetrlkqfanfakngqtiaaphlpfpgightysadgksyqwipihfkd

SCOPe Domain Coordinates for d4xuka_:

Click to download the PDB-style file with coordinates for d4xuka_.
(The format of our PDB-style files is described here.)

Timeline for d4xuka_: