Lineage for d1zsca_ (1zsc A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2077896Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2077897Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2077898Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2077899Protein Carbonic anhydrase [51071] (10 species)
  7. 2077938Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (682 PDB entries)
    Uniprot P00918
  8. 2078326Domain d1zsca_: 1zsc A: [27845]
    complexed with zn; mutant

Details for d1zsca_

PDB Entry: 1zsc (more details), 1.8 Å

PDB Description: carbonic anhydrase ii mutant e117q, holo form
PDB Compounds: (A:) carbonic anhydrase II

SCOPe Domain Sequences for d1zsca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zsca_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaqlhlvhw
ntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgl
lpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasfk

SCOPe Domain Coordinates for d1zsca_:

Click to download the PDB-style file with coordinates for d1zsca_.
(The format of our PDB-style files is described here.)

Timeline for d1zsca_: