Lineage for d4wozd_ (4woz D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2098336Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2098337Protein automated matches [190115] (75 species)
    not a true protein
  7. 2098750Species Peptoclostridium difficile [TaxId:1496] [278431] (1 PDB entry)
  8. 2098754Domain d4wozd_: 4woz D: [278442]
    automated match to d2ygya_
    complexed with mn9

Details for d4wozd_

PDB Entry: 4woz (more details), 1.96 Å

PDB Description: crystal structures of cdnal from clostridium difficile in complex with mannosamine
PDB Compounds: (D:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d4wozd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wozd_ c.1.10.0 (D:) automated matches {Peptoclostridium difficile [TaxId: 1496]}
tdmkgiysallvsfdkegninekglrqiirhnidvckvdglyvggstgenfmlstdekkr
ifeiakdevkeeikliaqvgsvnlkeavelakfttdlgydaisavtpfyykfdfeeikhy
yntiinsvdnrliiysipfltgvdmsldqfgelfenekiigvkftaadfyllermrktfp
nklifagfdemmlpatvlgvdgaigstfnvngvrarqifeltknekisealevqhvtndl
itdilgnglyqtikllleeqgveagycrqpmkeatdemksrakeiyrkyf

SCOPe Domain Coordinates for d4wozd_:

Click to download the PDB-style file with coordinates for d4wozd_.
(The format of our PDB-style files is described here.)

Timeline for d4wozd_: