| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
| Protein automated matches [190115] (94 species) not a true protein |
| Species Peptoclostridium difficile [TaxId:1496] [278431] (1 PDB entry) |
| Domain d4wozd_: 4woz D: [278442] automated match to d2ygya_ complexed with mn9 |
PDB Entry: 4woz (more details), 1.96 Å
SCOPe Domain Sequences for d4wozd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wozd_ c.1.10.0 (D:) automated matches {Peptoclostridium difficile [TaxId: 1496]}
tdmkgiysallvsfdkegninekglrqiirhnidvckvdglyvggstgenfmlstdekkr
ifeiakdevkeeikliaqvgsvnlkeavelakfttdlgydaisavtpfyykfdfeeikhy
yntiinsvdnrliiysipfltgvdmsldqfgelfenekiigvkftaadfyllermrktfp
nklifagfdemmlpatvlgvdgaigstfnvngvrarqifeltknekisealevqhvtndl
itdilgnglyqtikllleeqgveagycrqpmkeatdemksrakeiyrkyf
Timeline for d4wozd_: