Lineage for d4wnnc_ (4wnn C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987252Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1987253Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1987254Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1987741Protein automated matches [193445] (6 species)
    not a true protein
  7. 1987765Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256335] (4 PDB entries)
  8. 1987772Domain d4wnnc_: 4wnn C: [278438]
    automated match to d1id3c_
    protein/DNA complex; complexed with po4

Details for d4wnnc_

PDB Entry: 4wnn (more details), 1.8 Å

PDB Description: spt16-h2a-h2b fact histone complex
PDB Compounds: (C:) histone h2a.1

SCOPe Domain Sequences for d4wnnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wnnc_ a.22.1.1 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
srsakagltfpvgrvhrllrrgnyaqrigsgapvyltavleylaaeilelagnaardnkk
triiprhlqlairnddelnkllg

SCOPe Domain Coordinates for d4wnnc_:

Click to download the PDB-style file with coordinates for d4wnnc_.
(The format of our PDB-style files is described here.)

Timeline for d4wnnc_: