Lineage for d4wjea_ (4wje A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826026Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2826483Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2826484Protein automated matches [190605] (25 species)
    not a true protein
  7. 2826635Species Trichomonas vaginalis [TaxId:5722] [195009] (12 PDB entries)
  8. 2826637Domain d4wjea_: 4wje A: [278427]
    automated match to d3qsta_
    complexed with na

Details for d4wjea_

PDB Entry: 4wje (more details), 1.29 Å

PDB Description: crystal structure of trichomonas vaginalis triosephosphate isomerase v45a at 1.3 angstroms
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d4wjea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wjea_ c.1.1.0 (A:) automated matches {Trichomonas vaginalis [TaxId: 5722]}
rtffvggnwkanpktvqeaeklvemlngakvegnvevvvaapfaflptlqqklrkdwkvs
aenvftkpngaftgevtvpmiksfgiewtilghserrdilkeddeflaakakfalengmk
iiyccgehlsereagkasefvsaqiekmipaipagkwddvviayepiwaigtgkvastqd
aqemckvirdilaakvgadiankvrilyggsvkpnncnelaacpdvdgflvggasleagf
inivnsnvhs

SCOPe Domain Coordinates for d4wjea_:

Click to download the PDB-style file with coordinates for d4wjea_.
(The format of our PDB-style files is described here.)

Timeline for d4wjea_: