Lineage for d4tneb_ (4tne B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2041484Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2041793Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2041794Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 2041795Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 2041816Species Human (Homo sapiens) [TaxId:9606] [49475] (276 PDB entries)
    Uniprot P02766 31-143
  8. 2042182Domain d4tneb_: 4tne B: [278421]
    automated match to d1bzea_
    complexed with gol; mutant

Details for d4tneb_

PDB Entry: 4tne (more details), 1.55 Å

PDB Description: crystal structure of human transthyretin thr119tyr mutant
PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d4tneb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tneb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysystyavvtn

SCOPe Domain Coordinates for d4tneb_:

Click to download the PDB-style file with coordinates for d4tneb_.
(The format of our PDB-style files is described here.)

Timeline for d4tneb_: