Lineage for d1fr4a_ (1fr4 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2067964Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2067965Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2067966Family b.74.1.1: Carbonic anhydrase [51070] (2 protein domains)
    automatically mapped to Pfam PF00194
  6. 2067967Protein Carbonic anhydrase [51071] (10 species)
  7. 2068005Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (675 PDB entries)
    Uniprot P00918
  8. 2068274Domain d1fr4a_: 1fr4 A: [27842]
    complexed with cu, so4

Details for d1fr4a_

PDB Entry: 1fr4 (more details), 1.6 Å

PDB Description: x-ray crystal structure of copper-bound f93i/f95m/w97v carbonic anhydrase (caii) variant
PDB Compounds: (A:) carbonic anhydrase II

SCOPe Domain Sequences for d1fr4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fr4a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hafnvefddsqdkavlkggpldgtyrliqihmhvgsldgqgsehtvdkkkyaaelhlvhw
ntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgl
lpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasfk

SCOPe Domain Coordinates for d1fr4a_:

Click to download the PDB-style file with coordinates for d1fr4a_.
(The format of our PDB-style files is described here.)

Timeline for d1fr4a_: