SCOPe 2.07: Domain d1caja_: 1caj A:

Lineage for d1caja_ (1caj A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (971 PDB entries)
   Uniprot P00918

8. Domain d1caja_: 1caj A: [27841]
   complexed with so4, zn

Details for d1caja_

PDB Entry: 1caj, 1.9 Å

PDB Description: structural analysis of the zinc hydroxide-thr 199-glu 106 hydrogen bonding network in human carbonic anhydrase ii

PDB Compounds: (A:) carbonic anhydrase II

SCOPe Domain Sequences for d1caja_:

Sequence; same for both SEQRES and ATOM records:

>d1caja_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsdhtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

Timeline for d1caja_:

• d1caja_ first appeared (with stable ids) in SCOP 1.55, called d1caj__
  
• d1caja_ appears in SCOPe 2.06
  
• d1caja_ appears in the current release, SCOPe 2.08