Lineage for d4rlda1 (4rld A:-4-327)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2061036Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 2061037Protein automated matches [190954] (10 species)
    not a true protein
  7. 2061038Species Blattella germanica [TaxId:6973] [189570] (4 PDB entries)
  8. 2061043Domain d4rlda1: 4rld A:-4-327 [278406]
    Other proteins in same PDB: d4rlda2, d4rldb2, d4rldc2, d4rldd2
    automated match to d1yg9a_
    complexed with zn; mutant

Details for d4rlda1

PDB Entry: 4rld (more details), 2.9 Å

PDB Description: crystal structure of kkf mutant of bla g 2 protein
PDB Compounds: (A:) Aspartic protease Bla g 2

SCOPe Domain Sequences for d4rlda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rlda1 b.50.1.0 (A:-4-327) automated matches {Blattella germanica [TaxId: 6973]}
vplyklvhvfintqyagitkignqnfltvfdstscnvvvasqecvggacvcpnlqkyekl
kpkyisdgnvqvkffdtgsavgrgiedsltisqlttsqqdivladelsqevcilsadvvv
giaapgcpnalagktvlenfveenliapvfsihharfqdgehygeiifggsdwkyvdgef
tyvplvgddswkfrldgvkigdttvapagtqaiidtskaiivgpkayvnpineaigcvve
ktttrrickldcsaipslpdvtfvingrnfnissqyyiqqngnlcysgfqpcghsdhffi
gdffvdhyysefnwenktmgfgrsve

SCOPe Domain Coordinates for d4rlda1:

Click to download the PDB-style file with coordinates for d4rlda1.
(The format of our PDB-style files is described here.)

Timeline for d4rlda1:

  • d4rlda1 first appeared in SCOPe 2.05, called d4rlda_