Lineage for d2n4va_ (2n4v A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2811242Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 2811243Superfamily b.72.1: WW domain [51045] (2 families) (S)
  5. 2811244Family b.72.1.1: WW domain [51046] (13 proteins)
  6. 2811340Protein automated matches [192459] (3 species)
    not a true protein
  7. 2811343Species Human (Homo sapiens) [TaxId:9606] [161325] (20 PDB entries)
  8. 2811353Domain d2n4va_: 2n4v A: [278402]
    automated match to d2rm0w1
    mutant

Details for d2n4va_

PDB Entry: 2n4v (more details)

PDB Description: nmr structure of fbp28 ww domain t456d mutant
PDB Compounds: (A:) Transcription elongation regulator 1

SCOPe Domain Sequences for d2n4va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n4va_ b.72.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gatavsewteyktadgktyyynnrtlesdwekpqelk

SCOPe Domain Coordinates for d2n4va_:

Click to download the PDB-style file with coordinates for d2n4va_.
(The format of our PDB-style files is described here.)

Timeline for d2n4va_: