Lineage for d4jkla2 (4jkl A:179-272)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2763271Species Streptococcus agalactiae [TaxId:208435] [278386] (2 PDB entries)
  8. 2763272Domain d4jkla2: 4jkl A:179-272 [278395]
    Other proteins in same PDB: d4jkla1, d4jkla3, d4jkla4, d4jklb1, d4jklb3, d4jklb4
    automated match to d4jkmb2
    complexed with mg

Details for d4jkla2

PDB Entry: 4jkl (more details), 2.29 Å

PDB Description: crystal structure of streptococcus agalactiae beta-glucuronidase in space group p21212
PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d4jkla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jkla2 b.1.4.0 (A:179-272) automated matches {Streptococcus agalactiae [TaxId: 208435]}
nhifdititsrlsddlqsadlhflvetnqkvdevrisvfdednklvgetkdsrlflsdvh
lwevlnaylytarveifvdnqlqdvyeenfglre

SCOPe Domain Coordinates for d4jkla2:

Click to download the PDB-style file with coordinates for d4jkla2.
(The format of our PDB-style files is described here.)

Timeline for d4jkla2: