![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (51 species) not a true protein |
![]() | Species Streptococcus agalactiae [TaxId:208435] [278382] (2 PDB entries) |
![]() | Domain d4jkla1: 4jkl A:1-178 [278394] Other proteins in same PDB: d4jkla2, d4jkla3, d4jkla4, d4jklb2, d4jklb3, d4jklb4 automated match to d4jkmb1 complexed with mg |
PDB Entry: 4jkl (more details), 2.29 Å
SCOPe Domain Sequences for d4jkla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jkla1 b.18.1.0 (A:1-178) automated matches {Streptococcus agalactiae [TaxId: 208435]} mlyplltktrntydlggiwnfklgehnpnellpsdevmviptsfndlmvskekrdyigdf wyekvievpkvsedeemvlrfgsvthqakiyvdgvlvgehkggftpfevlvpeckynnek ikvsicannvldyttlpvgnyseiiqedgsikkkvrenfdffnyagvhrplklmirpk
Timeline for d4jkla1:
![]() Domains from other chains: (mouse over for more information) d4jklb1, d4jklb2, d4jklb3, d4jklb4 |