Lineage for d4jkka3 (4jkk A:273-596)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2084190Species Streptococcus agalactiae [TaxId:208435] [278390] (2 PDB entries)
  8. 2084193Domain d4jkka3: 4jkk A:273-596 [278392]
    Other proteins in same PDB: d4jkka1, d4jkka2, d4jkka4
    automated match to d4jkmb3
    complexed with mg

Details for d4jkka3

PDB Entry: 4jkk (more details), 2.59 Å

PDB Description: crystal structure of streptococcus agalactiae beta-glucuronidase in space group i222
PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d4jkka3:

Sequence, based on SEQRES records: (download)

>d4jkka3 c.1.8.0 (A:273-596) automated matches {Streptococcus agalactiae [TaxId: 208435]}
ievtngqfllnrkpiyfkgfgkhedtfingrglneaanlmdlnllkdmgansfrtshypy
seemmrladrmgvlvidevpavglfqnfnasldlspkdngtwnlmqtkaaheqaiqelvk
rdknhpsvvmwvvanepasheagahdyfeplvklykdldpqkrpvtlvnilmatpdrdqv
mdlvdvvclnryygwyvdhgdltnaevgirkellewqdkfpdkpiiiteygadtlpglhs
twnipyteefqcdfyemshrvfdgipnlvgeqvwnfadfetnlmilrvqgnhkglfsrnr
qpkqvvkefkkrwmtiphyhnkkn

Sequence, based on observed residues (ATOM records): (download)

>d4jkka3 c.1.8.0 (A:273-596) automated matches {Streptococcus agalactiae [TaxId: 208435]}
ievtngqfllnrkpiyfkgfgkhedtfingrglneaanlmdlnllkdmgansfrtshypy
seemmrladrmgvlvidevpavglfqndngtwnlmqtkaaheqaiqelvkrdknhpsvvm
wvvanepasheagahdyfeplvklykdldpqkrpvtlvnilmatpdrdqvmdlvdvvcln
ryygwyvdhgdltnaevgirkellewqdkfpdkpiiiteygadtlpglhstwnipyteef
qcdfyemshrvfdgipnlvgeqvwnfadfetnlmilrvqgnhkglfsrnrqpkqvvkefk
krwmtiphyhnkkn

SCOPe Domain Coordinates for d4jkka3:

Click to download the PDB-style file with coordinates for d4jkka3.
(The format of our PDB-style files is described here.)

Timeline for d4jkka3: