SCOP 1.65: Domain d1cni__: 1cni -

Lineage for d1cni__ (1cni -)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (1 family)

5. Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)

6. Protein Carbonic anhydrase [51071] (9 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (151 PDB entries)

8. Domain d1cni__: 1cni - [27839]
   complexed with hg, zn; mutant

Details for d1cni__

PDB Entry: 1cni, 1.8 Å

PDB Description: x-ray crystallographic studies of engineered hydrogen bond networks in a protein-zinc binding site

SCOP Domain Sequences for d1cni__:

Sequence; same for both SEQRES and ATOM records:

>d1cni__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hafnvefddsqdkavlkggpldgtyrliafhfhwgsldgqgsehtvdkkkyaaelhlvhw
ntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgl
lpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasfk

Timeline for d1cni__:

• d1cni__ first appeared (with stable ids) in SCOP 1.55
  
• d1cni__ appears in SCOP 1.63
  
• d1cni__ appears in SCOP 1.67
  
• d1cni__ appears in the current release, SCOPe 2.08, called d1cnia_