![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
![]() | Protein automated matches [254633] (19 species) not a true protein |
![]() | Species Streptococcus agalactiae [TaxId:208435] [278386] (2 PDB entries) |
![]() | Domain d4jklb2: 4jkl B:179-272 [278389] Other proteins in same PDB: d4jkla1, d4jkla3, d4jkla4, d4jklb1, d4jklb3, d4jklb4 automated match to d4jkmb2 complexed with mg |
PDB Entry: 4jkl (more details), 2.29 Å
SCOPe Domain Sequences for d4jklb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jklb2 b.1.4.0 (B:179-272) automated matches {Streptococcus agalactiae [TaxId: 208435]} nhifdititsrlsddlqsadlhflvetnqkvdevrisvfdednklvgetkdsrlflsdvh lwevlnaylytarveifvdnqlqdvyeenfglre
Timeline for d4jklb2:
![]() Domains from other chains: (mouse over for more information) d4jkla1, d4jkla2, d4jkla3, d4jkla4 |