SCOPe 2.06: Domain d4jkka2: 4jkk A:179-272

Lineage for d4jkka2 (4jkk A:179-272)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families)

5. Family b.1.4.0: automated matches [254272] (1 protein)
   not a true family

6. Protein automated matches [254633] (8 species)
   not a true protein

7. Species Streptococcus agalactiae [TaxId:208435] [278386] (2 PDB entries)

8. Domain d4jkka2: 4jkk A:179-272 [278388]
   Other proteins in same PDB: d4jkka1, d4jkka3, d4jkka4
   automated match to d4jkmb2
   complexed with mg

Details for d4jkka2

PDB Entry: 4jkk, 2.59 Å

PDB Description: crystal structure of streptococcus agalactiae beta-glucuronidase in space group i222

PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d4jkka2:

Sequence; same for both SEQRES and ATOM records:

>d4jkka2 b.1.4.0 (A:179-272) automated matches {Streptococcus agalactiae [TaxId: 208435]}
nhifdititsrlsddlqsadlhflvetnqkvdevrisvfdednklvgetkdsrlflsdvh
lwevlnaylytarveifvdnqlqdvyeenfglre

Timeline for d4jkka2:

• d4jkka2 first appeared in SCOPe 2.05
  
• d4jkka2 appears in SCOPe 2.07
  
• d4jkka2 appears in the current release, SCOPe 2.08