![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
![]() | Protein automated matches [190891] (38 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [272972] (5 PDB entries) |
![]() | Domain d5e38d1: 5e38 D:2-204 [278370] Other proteins in same PDB: d5e38a2, d5e38c2, d5e38d2 automated match to d1i5ea_ mutant |
PDB Entry: 5e38 (more details), 3 Å
SCOPe Domain Sequences for d5e38d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e38d1 c.61.1.0 (D:2-204) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} qvhvvdhplaaarlttlrdertdnagfraalreltllliyeatrdapcepvpirtplaet vgsrltkppllvpvlraglgmvdeahaalpeahvgfvgvardeqthqpvpyldslpddlt dvpvmvldpmvatggsmthtlgllisrgaaditvlcvvaapegiaalqkaapnvrlftaa ideglnevayivpglgdagdrqf
Timeline for d5e38d1: