Lineage for d5e38a1 (5e38 A:2-204)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2892061Species Mycobacterium tuberculosis [TaxId:83332] [272972] (5 PDB entries)
  8. 2892080Domain d5e38a1: 5e38 A:2-204 [278366]
    Other proteins in same PDB: d5e38a2, d5e38c2, d5e38d2
    automated match to d1o5oa_
    mutant

Details for d5e38a1

PDB Entry: 5e38 (more details), 3 Å

PDB Description: structural basis of mapping the spontaneous mutations with 5- flourouracil in uracil phosphoribosyltransferase from mycobacterium tuberculosis
PDB Compounds: (A:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d5e38a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e38a1 c.61.1.0 (A:2-204) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qvhvvdhplaaarlttlrdertdnagfraalreltllliyeatrdapcepvpirtplaet
vgsrltkppllvpvlraglgmvdeahaalpeahvgfvgvardeqthqpvpyldslpddlt
dvpvmvldpmvatggsmthtlgllisrgaaditvlcvvaapegiaalqkaapnvrlftaa
ideglnevayivpglgdagdrqf

SCOPe Domain Coordinates for d5e38a1:

Click to download the PDB-style file with coordinates for d5e38a1.
(The format of our PDB-style files is described here.)

Timeline for d5e38a1: