SCOPe 2.08: Domain d5e38a1: 5e38 A:2-204

Lineage for d5e38a1 (5e38 A:2-204)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [272972] (5 PDB entries)

8. Domain d5e38a1: 5e38 A:2-204 [278366]
   Other proteins in same PDB: d5e38a2, d5e38c2, d5e38d2
   automated match to d1o5oa_
   mutant

Details for d5e38a1

PDB Entry: 5e38, 3 Å

PDB Description: structural basis of mapping the spontaneous mutations with 5- flourouracil in uracil phosphoribosyltransferase from mycobacterium tuberculosis

PDB Compounds: (A:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d5e38a1:

Sequence; same for both SEQRES and ATOM records:

>d5e38a1 c.61.1.0 (A:2-204) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qvhvvdhplaaarlttlrdertdnagfraalreltllliyeatrdapcepvpirtplaet
vgsrltkppllvpvlraglgmvdeahaalpeahvgfvgvardeqthqpvpyldslpddlt
dvpvmvldpmvatggsmthtlgllisrgaaditvlcvvaapegiaalqkaapnvrlftaa
ideglnevayivpglgdagdrqf

Timeline for d5e38a1:

• d5e38a1 first appeared in SCOPe 2.05
  
• d5e38a1 appears in SCOPe 2.07